🎁 Code: '500freebie' - Spend $500, add an item from Other Peptides, get it for free (exclusions apply) 🚚 Free Shipping when you spend $350 or more
Polaris Peptides Logo
0
$0.00
Buy IGF1-LR3 online, 99% purity lab tested

IGF1-LR3 1mg

$85.00

In stock

Qty Price
1 $85.00
2 - 4 $76.50
5 - 9 $72.25
10 - 14 $65.45
15 - 19 $62.90
20 + $59.50

Only the lyophilized product is provided. All researchers are assumed to have all necessary supplies to conduct their research, such as reconstitution solution and disinfecting aids to maintain Sterility.

[cuw_fbt]
Description

Buy IGF1-LR3 Online for Cutting-Edge Scientific Studies

Looking to buy IGF1-LR3 for your advanced research? You’ve come to the right place! Our high-purity IGF1-LR3 is now available for online purchase, perfect for your pioneering scientific investigations.

Why Choose Our IGF1-LR3 for Research?

When you buy IGF1-LR3 from us, you’re guaranteed:
  • 99%+ purity
  • Fast global shipping
  • Bulk order discounts
  • Comprehensive certificate of analysis

About IGF1-LR3 Peptide

IGF1-LR3, or Insulin-like Growth Factor-1 Long Arg3, is a modified form of IGF-1, engineered for enhanced potency and stability. This synthetic peptide has become invaluable in studies focusing on:
  • Muscle growth and repair
  • Cellular proliferation and differentiation
  • Metabolic processes
  • Anti-aging research

Key Features of Our IGF1-LR3

  • Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Molecular Weight: 9200 daltons
  • Length: 83 amino acids
  • Appearance: Lyophilized white powder

Buy IGF1-LR3 1mg Online Today

Whether you’re conducting in vitro cell culture experiments or in vivo animal studies, our IGF1-LR3 1mg vials are ideal for your research needs. Elevate your scientific investigations by purchasing IGF1-LR3 online through our secure platform.

How to Buy IGF1-LR3 Online

  1. Visit our product page
  2. Choose your preferred quantity (1mg vials available)
  3. Add to cart and proceed to checkout
  4. Complete your purchase securely

Why Researchers Buy IGF1-LR3 from Us

  • Trusted supplier for research institutions
  • Competitive pricing on IGF1-LR3 1mg vials
  • Knowledgeable customer support
Don’t miss this opportunity to advance your studies in cellular biology, muscle physiology, and anti-aging research. Buy IGF1-LR3 online now and unlock new possibilities in your scientific endeavors! Disclaimer: This product is strictly for research purposes only. Not for human use or consumption.

Why Researchers Buy IGF1-LR3 from Us

  • Trusted supplier for research institutions
  • Competitive pricing on IGF1-LR3 1mg vials
  • Knowledgeable customer support
Don’t miss this opportunity to advance your studies in cellular biology, muscle physiology, and anti-aging research. Buy IGF1-LR3 online now and unlock new possibilities in your scientific endeavors! Disclaimer: This product is strictly for research purposes only. Not for human use or consumption.
CID 381123731
Molecular Formula
Molecular Weight g/mol
Structure Image Chemical Structure

Latest Lab Results

Chromate

Chromate

November 19, 2024

Lab Results:

Mass: 1.031mg

Purity: 99.827%

Batch:

POL-IGF1-1

Related Products

AHK-Cu 1g (Topical, raw)

GHK-Cu Product Image

$45.00

View
Buy

Melanotan II 17mg

$45.00

View
MT-2
Buy MT-2

NAD+ 500mg

Buy NAD+ 500mg online

$90.00

View
NAD+
Buy NAD+

Tesamorelin 10mg

Tesamorelin 10mg

$65.00

View
Tesamorelin
Buy Tesamorelin

N-Acetyl Selank Amidate 15mg

$50.00

View
NA Selank
Buy NA Selank

Thymosin Alpha-1 10mg

thymosin alpha-1 10mg peptide vial for sale

Original price was: $75.00.Current price is: $65.00.

View
TA-1
Buy TA-1
Polaris Peptides Logo

At Polaris Peptides, we are dedicated to supporting the scientific community by supplying high-quality peptides designed exclusively for research and development endeavors of professionals. Our products are crafted for investigative purposes and are not suitable for direct human consumption or consumers, nor are they intended for clinical or therapeutic use. We uphold a strict policy to ensure our peptides are recognized distinctly from prescription medications as an entity committed to research.

Polaris Peptides is a chemical supplier. Polaris Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act. Polaris Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act.

Products

Legal

Customer Service

Need to get in touch?

You can reach Customer Support by sending an email to su*****@*************es.com

To contact management, please email *@*************es.com

You may also call or leave us a message at (800) 273-9462. Please note during busy times (such as Black Friday) we may not be able to answer all calls. Please leave a voicemail with all necessary details or email us at our support email.

Subscribe for exclusive offer updates!

We care about keeping your data private. Read our Privacy Policy.
The information and statements provided by Polaris Peptides have not been assessed by the US Food and Drug Administration. Our products, alongside any claims related to them, are not formulated to diagnose, treat, cure, or prevent any condition or disease. For complete confidence in our quality commitment, we offer a Money Back Guarantee under specific Terms and Conditions. See our Our Guarantee page for complete details.

© 2025 Polaris Peptides. All Rights Reserved.

  • American Express
  • Discover
  • Mastercard
  • Venmo
  • Visa

Main Menu
Shop Now

Get 10% Off Your First Order

Join our Polaris Insiders program to get rewarded for loyalty with exclusive deals, news about upcoming products, and more.

Are you 18 or older?

You must be 18 years old or older in order to access our website. Please verify your age.

I am over 18
I am under 18
SHARE YOUR CART
0