🎁 Code: '500freebie' - Spend $500, add an item from Other Peptides, get it for free (exclusions apply) 🚚 Free Shipping when you spend $350 or more

$0.00

LL-37 10mg

$125.00

In stock

Title	Qty	Price
Bulk Discount All Prods	1	0% $125.00
Bulk Discount All Prods	2 - 4	10% $112.50
Bulk Discount All Prods	5 - 9	15% $106.25
Bulk Discount All Prods	10 - 14	23% $96.25
Bulk Discount All Prods	15 - 19	26% $92.50
Bulk Discount All Prods	20 +	30% $87.50

Only the lyophilized product is provided. All researchers are assumed to have all necessary supplies to conduct their research, such as reconstitution solution and disinfecting aids to maintain Sterility.

[cuw_fbt]

Description

LL-37: Pioneering Antimicrobial Peptide for Research

Advance Your Immunology Studies with LL-37

LL-37, a cathelicidin-derived antimicrobial peptide, has emerged as a crucial focus in immunology and microbiology research. This multifunctional peptide offers exciting possibilities for studying innate immune responses and novel antimicrobial strategies.

LL-37 Specifications:

Sequence: [LL-37, 37 aa]
Molecular Weight: 4493.33 g/mol
Purity: >95%
Available in 10mg vials

Research Applications:

Antimicrobial mechanism studies
Innate immunity investigations
Wound healing research
Anti-biofilm activity analysis

How to Buy LL-37 Online

Acquiring high-quality LL-37 for your research is straightforward:

Visit our LL-37 product page
Select the 10mg option
Proceed through our secure checkout process

Why Source LL-37 From Us?

Rigorous quality control ensures consistent purity
Comprehensive documentation, including certificates of analysis
Competitive pricing for research budgets
Prompt, discreet shipping to research facilities worldwide

Expand Your Research Horizons

Incorporate LL-37 into your studies to explore its diverse biological activities. Whether you’re investigating antimicrobial resistance, wound healing processes, or immune modulation, LL-37 offers a versatile tool for cutting-edge research. To buy LL-37 10mg or inquire about bulk orders, please contact our dedicated research support team. We’re committed to supporting your groundbreaking work in immunology and microbiology. Important: LL-37 is intended for research use only. Not for diagnostic, therapeutic, or human use. Elevate your antimicrobial peptide research – purchase LL-37 through our trusted platform today.

Chemical Info

No chemical information available.

Lab Results

Latest Lab Results

Chromate

November 11, 2024

Lab Results:

Mass: 11.13mg

Purity: 99.805%

Batch:

POL-LL3710-1

Related Products

CJC-1295 (no DAC) 10mg

$60.00

TB-500 10mg

Original price was: $80.00.Current price is: $70.00.

Epithalon 10mg

Original price was: $45.00.Current price is: $35.00.

Melanotan II 17mg

$45.00

BPC-157 5mg

$35.00

PE 22-28 13mg

$45.00

At Polaris Peptides, we are dedicated to supporting the scientific community by supplying high-quality peptides designed exclusively for research and development endeavors of professionals. Our products are crafted for investigative purposes and are not suitable for direct human consumption or consumers, nor are they intended for clinical or therapeutic use. We uphold a strict policy to ensure our peptides are recognized distinctly from prescription medications as an entity committed to research.

Polaris Peptides is a chemical supplier. Polaris Peptides is not a compounding pharmacy or chemical compounding facility as defined under 503A of the Federal Food, Drug, and Cosmetic act. Polaris Peptides is not an outsourcing facility as defined under 503B of the Federal Food, Drug, and Cosmetic act.

Products

Legal

Customer Service

Need to get in touch?

You can reach Customer Support by sending an email to su*****@*************es.com

To contact management, please email *@*************es.com

You may also call or leave us a message at (800) 273-9462. Please note during busy times (such as Black Friday) we may not be able to answer all calls. Please leave a voicemail with all necessary details or email us at our support email.

Subscribe for exclusive offer updates!

We care about keeping your data private. Read our Privacy Policy.

The information and statements provided by Polaris Peptides have not been assessed by the US Food and Drug Administration. Our products, alongside any claims related to them, are not formulated to diagnose, treat, cure, or prevent any condition or disease. For complete confidence in our quality commitment, we offer a Money Back Guarantee under specific Terms and Conditions. See our Our Guarantee page for complete details.